Scaffold 2229135792

Overview

Basic Information

• Taxon OID: 2228664000
• Scaffold ID: 2229135792
• Source Dataset Name: Panchlora_midgut_metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama

Source Dataset Sampling Location

• Location Name: Panama
• Coordinates
  • Lat. (^o): 9.116667
  • Long. (^o): -79.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023128	Metagenome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
2229348053	F023128	N/A	VLYGCEACSIILREERKLRVFENRILRRILGPKGDANGE