| Basic Information | |
|---|---|
| Taxon OID | 2228664000 Open in IMG/M |
| Scaffold ID | 2228974018 Open in IMG/M |
| Source Dataset Name | Panchlora_midgut_metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 605 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama | |||||||
| Coordinates | Lat. (o) | 9.116667 | Long. (o) | -79.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005709 | Metagenome | 392 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2229158100 | F005709 | AGG | MTIVVKSVLTRDGYCTREIMMRIAIAKEAFNRKISLLTNKLNIELRKKLVRCYVWSIALYGS |
| ⦗Top⦘ |