Scaffold 2228974018

Overview

Basic Information

• Taxon OID: 2228664000
• Scaffold ID: 2228974018
• Source Dataset Name: Panchlora_midgut_metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 605
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama

Source Dataset Sampling Location

• Location Name: Panama
• Coordinates
  • Lat. (^o): 9.116667
  • Long. (^o): -79.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005709	Metagenome	392	Y

Sequences

Protein ID	Family	RBS	Sequence
2229158100	F005709	AGG	MTIVVKSVLTRDGYCTREIMMRIAIAKEAFNRKISLLTNKLNIELRKKLVRCYVWSIALYGS