| Basic Information | |
|---|---|
| Taxon OID | 2222084011 Open in IMG/M |
| Scaffold ID | 2225762369 Open in IMG/M |
| Source Dataset Name | Coastal lagoon microbial communities from Albufera, Spain - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University Miguel Hernandez |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2319 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: La Albufera de Valencia | |||||||
| Coordinates | Lat. (o) | 39.330917 | Long. (o) | -0.343 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087100 | Metagenome | 110 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2225180055 | F087100 | N/A | MKCKHCGYEYQRKPQEQGEMVDLHLMTKAQGMQIATTXXMYQKAQLAKAKVISPYWVLHNQCKTKAEALEFIRFMGWKPGWAFHNKDRFPILK |
| ⦗Top⦘ |