Basic Information | |
---|---|
Taxon OID | 2222084002 Open in IMG/M |
Scaffold ID | DRAFT_c93989 Open in IMG/M |
Source Dataset Name | Subtropical soil microbial communities from Bundaberg Australia-sugarcane farm |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Australian Genome Research Facility |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 504 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil → Subtropical Soil Microbial Communities From Bundaberg Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Australia: Bundaberg, Queensland | |||||||
Coordinates | Lat. (o) | -24.9 | Long. (o) | 152.39 | Alt. (m) | Depth (m) | 0 to .03 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001758 | Metagenome / Metatranscriptome | 640 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
DRAFT_00044980 | F001758 | AGGA | VTGEKLGQAGWPGSSESGSKETKGEAEFNQFLWRRSRAVSIREKGLRNEERLETVPDSVK |
⦗Top⦘ |