Scaffold DRAFT_c44377

Overview

Basic Information

• Taxon OID: 2222084002
• Scaffold ID: DRAFT_c44377
• Source Dataset Name: Subtropical soil microbial communities from Bundaberg Australia-sugarcane farm
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Genome Research Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil → Subtropical Soil Microbial Communities From Bundaberg Australia

Source Dataset Sampling Location

• Location Name: Australia: Bundaberg, Queensland
• Coordinates
  • Lat. (^o): -24.9
  • Long. (^o): 152.39
  • Depth (m): 0 to .03

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000344	Metagenome / Metatranscriptome	1257	Y

Sequences

Protein ID	Family	RBS	Sequence
DRAFT_00498320	F000344	AGGA	MRPKHPHAAESGVGKHTTRESERAQACAAGKERVAN