Basic Information | |
---|---|
Taxon OID | 2222084001 Open in IMG/M |
Scaffold ID | 2222265722 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Dispersant |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Alabama State University |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 532 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Daulphin Laboratory, Alabama, USA | |||||||
Coordinates | Lat. (o) | 30.15 | Long. (o) | -88.446 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015473 | Metagenome / Metatranscriptome | 254 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2222325572 | F015473 | N/A | MSKEKKEGFFSNVRNQIIAGAGVVLTTLGTVFTDKIEEFFGVEDDAAVEVVQEQNVNVEGPTITINIPEQQKDTVVKKVYVKPKPKLTETEKRKKEGIDW |
⦗Top⦘ |