| Basic Information | |
|---|---|
| Taxon OID | 2209111015 Open in IMG/M |
| Scaffold ID | 2218387765 Open in IMG/M |
| Source Dataset Name | Tailings pond microbial communities from Northern Alberta -TP6_2008_2010: |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1478 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092306 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2218344371 | F092306 | AGGAGG | MTMPATFYEGPGWQQSSEPILIVDVQEADIWPVDNRSGSGTKDQIDEGLHPIVAIGSQTAAGGRPLNLTGVVISCNISVHGTATDRVMVNIADGAIVRQYVANVLTYNMGAAATFEQAPVVGQPVYVDDSDDLSEGVTCSLSPLNDAGVRNPLAGYLWYCQDEIADGQVGGSRATSTFDTSLLNSLVEQEYCVLLVNAARELA |
| ⦗Top⦘ |