| Basic Information | |
|---|---|
| Taxon OID | 2209111013 Open in IMG/M |
| Scaffold ID | DRAFT_Contig_126236 Open in IMG/M |
| Source Dataset Name | Subtropical soil microbial communities from Bundaberg Australia-rainforest |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Australian Genome Research Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 516 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil → Subtropical Soil Microbial Communities From Bundaberg Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austrailia: Bundaberg, Queensland | |||||||
| Coordinates | Lat. (o) | -24.867 | Long. (o) | 152.351 | Alt. (m) | Depth (m) | 0 to .03 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014312 | Metagenome / Metatranscriptome | 264 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DRAFT_00468770 | F014312 | N/A | TANGVVRLWERVKAERFAVAMTPLVGAERLARKTERFSERPDKNG |
| ⦗Top⦘ |