| Basic Information | |
|---|---|
| Taxon OID | 2209111012 Open in IMG/M |
| Scaffold ID | le_contig00389.2750 Open in IMG/M |
| Source Dataset Name | 2000 evening metatranscriptome |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Leibniz Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 577 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Grosse Fuchskuhle | |||||||
| Coordinates | Lat. (o) | 53.1058 | Long. (o) | 12.9847 | Alt. (m) | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092248 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| le_00164460 | F092248 | N/A | LRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY |
| ⦗Top⦘ |