2209111012: 2000 evening metatranscriptome

Overview

Basic Information

• IMG/M Taxon OID: 2209111012
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0050868 | Gp0053095 | Ga0011210
• Sample Name: 2000 evening metatranscriptome
• Sequencing Status: Permanent Draft
• Sequencing Center: Leibniz Institute
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 8008326
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From Grosse Fuchskuhle, Germany, For Comparative Metatranscriptomics

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → lentic water body → fresh water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Germany: Grosse Fuchskuhle
• Coordinates
  • Lat. (^o): 53.1058
  • Long. (^o): 12.9847
  • Alt. (m): N/A
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092248	Metagenome / Metatranscriptome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
le_contig00389.2750	All Organisms → cellular organisms → Eukaryota	577

Sequences

Scaffold ID	Protein ID	Family	Sequence
le_contig00389.2750	le_00164460	F092248	LRLLLPLSDKVYLTFHASLEDMRSPEGSPDHSKSVGATGGVYKGQGRNQHKLMTYAY