 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2209111001 Open in IMG/M |
| Scaffold ID | 2210013218 Open in IMG/M |
| Source Dataset Name | Sinkhole freshwater microbial communities from Lake Huron, US, Illumina + 454 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 518 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Huron Michigan | |||||||
| Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | Depth (m) | 23 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010231 | Metagenome | 306 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2210205924 | F010231 | N/A | VHLAGFAPAFTLSFHDSECSRKPPNAHSLGRYVAF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |