Basic Information | |
---|---|
IMG/M Taxon OID | 2209111001 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045862 | Gp0053889 | Ga0011324 |
Sample Name | Sinkhole freshwater microbial communities from Lake Huron, US, Illumina + 454 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Michigan |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 39112987 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater biome → sinkhole → microbial mat material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Lake Huron Michigan | |||||||
Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | N/A | Depth (m) | 23 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010231 | Metagenome | 306 | Y |
F093370 | Metagenome / Metatranscriptome | 106 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2210013218 | Not Available | 518 | Open in IMG/M |
2210014010 | Not Available | 514 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
2210013218 | 2210205924 | F010231 | VHLAGFAPAFTLSFHDSECSRKPPNAHSLGRYVAF |
2210014010 | 2210207378 | F093370 | IPRNSTEPLKVGDQVQIVPEWQDPGDDKYERFVIEAPTDCTSVRIRTVVPGLVFQPGEWIEADRLVLLPAEN |
⦗Top⦘ |