NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2207183787

Scaffold 2207183787


Overview

Basic Information
Taxon OID2199352036 Open in IMG/M
Scaffold ID2207183787 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Oil_sample_6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAlabama State University
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)556
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.15Long. (o)-88.446Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034342Metagenome / Metatranscriptome175Y

Sequences

Protein IDFamilyRBSSequence
2209056199F034342N/AVKKPFKTPKNRALGASKESNFALGDIVSWKTWEISLENEIFETKEGLLIEIIEETRLENVVLIAKIMPFGASEYEFIPLFPSKKHKTGLFIACLARLRTQLTTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.