| Basic Information | |
|---|---|
| Taxon OID | 2199352033 Open in IMG/M |
| Scaffold ID | 2206853324 Open in IMG/M |
| Source Dataset Name | Cave microbial community (Wet rock wall) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Arizona Genomics Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 508 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces → Speleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011156 | Metagenome | 294 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2208589015 | F011156 | GGAG | MATTASITVDANLKARLADLARQAGQEVDEFVEALLRRIAEADVRFERGVPLFPRRPGAPILTVEDVDH |
| ⦗Top⦘ |