| Basic Information | |
|---|---|
| Taxon OID | 2199352032 Open in IMG/M |
| Scaffold ID | 2206612469 Open in IMG/M |
| Source Dataset Name | Cave microbial community (Speleothem A) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Arizona Genomics Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 524 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces → Speleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Arizona | |||||||
| Coordinates | Lat. (o) | 31.837801 | Long. (o) | -110.350292 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082936 | Metagenome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2208323757 | F082936 | N/A | KGYVVHGEMAYQAWIHGFRLGEVPIHFRNRRREASKLTTEEIYMALINFALLRFRYGFRPRQRVSTQVAP |
| ⦗Top⦘ |