| Basic Information | |
|---|---|
| Taxon OID | 2199352023 Open in IMG/M |
| Scaffold ID | CgraS_DRAFT__Contig_2267 Open in IMG/M |
| Source Dataset Name | C. gracilis enrichment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Eurofins Medigenomix GmbH |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 51590 |
| Total Scaffold Genes | 38 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (36.84%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Marine Media → Unclassified → Chaetoceros Gracilis Enriched → Chaetoceros Gracilis Enriched Algal Communities From Idaho National Lab, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Idaho National Lab, Idaho Falls | |||||||
| Coordinates | Lat. (o) | 43.4666667 | Long. (o) | -112.0333333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051162 | Metagenome / Metatranscriptome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CgraS_DRAFT_00278600 | F051162 | N/A | MPLVKLFARKTLSKPVNLSSLQQKLCSIWNTKPDTTKLILTRVDDWTNDSFQEDIYVDIRAYGKKERTRDMVMDGMQQVQKAFGEEGLVANVRLEVYDGEKYFHLPPPPSTPQN |
| ⦗Top⦘ |