Scaffold 2200534807

Overview

Basic Information

• Taxon OID: 2199352012
• Scaffold ID: 2200534807
• Source Dataset Name: Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2376
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley

Source Dataset Sampling Location

• Location Name: Davis, California, USA
• Coordinates
  • Lat. (^o): 38.5402727
  • Long. (^o): -121.7500776

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027361	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
2201028232	F027361	N/A	MATASQVQKNLQAAMREALRIQDRFVAEPLFAKTGRGHLKSEGISTISKIKANLSRKKASKPK