NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GZR05M102HVQVO

Scaffold GZR05M102HVQVO


Overview

Basic Information
Taxon OID2189573001 Open in IMG/M
Scaffold IDGZR05M102HVQVO Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)528
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m)0 to .21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073933Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
FD2_09372570F073933AGGAGMRYSGNQGRIDREEDVNPLICIRGSASPGHSYPMTPLHVTNTGDSPMEVMFSANPGDAITWLKVSPVEILPGESASIPLTLVVPSNAGPGENYVILTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.