NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GZTSFBX01EN399

Scaffold GZTSFBX01EN399


Overview

Basic Information
Taxon OID2170459024 Open in IMG/M
Scaffold IDGZTSFBX01EN399 Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)519
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m)0 to .21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008262Metagenome / Metatranscriptome336Y
F085296Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
FD1_02644200F008262N/ADHGTMTVAELERLMRVRQARCDMPASTLRCSGRFHDRTRVRTDSHLINWGRYGLGIYDTMTETTWHRRERAPSARFEFLGQLQARNPFR
FD1_02644210F085296AGGAMNEHCTPEADRNTFDGDAISRADREFLASLSDHPLVRHPLYSVPPPPRPNYEGCITIDERAEAQRACFPAALDWMLVNYAYYTG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.