Scaffold GZGNO2B02I2G20

Overview

Basic Information

• Taxon OID: 2170459023
• Scaffold ID: GZGNO2B02I2G20
• Source Dataset Name: Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 517
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Depth (m): 0 to .21

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051284	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
FA3_11409560	F051284	GGAGG	MPLEITQREMNGIYLLALNGRLVLGQESGGLLTVIDNLLASG