Basic Information | |
---|---|
Taxon OID | 2170459005 Open in IMG/M |
Scaffold ID | F1BAP7Q02ISA65 Open in IMG/M |
Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 559 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rothamsted, Harpenden, UK | |||||||
Coordinates | Lat. (o) | 51.804241 | Long. (o) | -0.372114 | Alt. (m) | Depth (m) | 0 to .21 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062592 | Metagenome / Metatranscriptome | 130 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
E41_00822640 | F062592 | N/A | NQDDLAKQAKELSELRSELARLKQIMGTVREALRCIDSYSYKSGMTSDAEKKAHAQLAEFMTKGF |
⦗Top⦘ |