| Basic Information | |
|---|---|
| Taxon OID | 2170459001 Open in IMG/M |
| Scaffold ID | W1_contig00594 Open in IMG/M |
| Source Dataset Name | soil microbial communities from McMurdo Dry Valleys (Wright Valley), Antarctica |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New Mexico |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1619 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Polar Desert → Polar Desert Microbial Communities From Mcmurdo Dry Valleys, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | McMurdo Dry Valleys (Wright Valley), Antarctica | |||||||
| Coordinates | Lat. (o) | 77.4475 | Long. (o) | 162.676389 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000584 | Metagenome / Metatranscriptome | 1007 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| W1_0594.00000010 | F000584 | N/A | MARKTHHKHSSTKGYRRLLDGLADLEGVHSVATGRVKPRMGSGRPVAPISKVRTTESGLSITINADGAIVDAYVVTDRPAEVAAAIAERGWSASS |
| ⦗Top⦘ |