Basic Information | |
---|---|
Taxon OID | 2166559021 Open in IMG/M |
Scaffold ID | LBLPB2_contig00048 Open in IMG/M |
Source Dataset Name | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from peak-bloom 2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1763 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | LaBonte Lake, Laramie, Wyoming | |||||||
Coordinates | Lat. (o) | 41.321 | Long. (o) | -105.586 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057778 | Metagenome | 136 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LBLPB2_02016620 | F057778 | AGGAG | VDEQAEEIKADLRDYYNSPERYTFQDFEDIFQDRDPFEFL |
⦗Top⦘ |