Basic Information | |
---|---|
Family ID | F057778 |
Family Type | Metagenome |
Number of Sequences | 136 |
Average Sequence Length | 41 residues |
Representative Sequence | MDEQAQEIREALEDYYANPEQYSLADLEEIFQDRDPFEFL |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 75.00 % |
% of genes near scaffold ends (potentially truncated) | 12.50 % |
% of genes from short scaffolds (< 2000 bps) | 58.09 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (44.853 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.912 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.971 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 16.91 |
PF09834 | DUF2061 | 2.21 |
PF00877 | NLPC_P60 | 2.21 |
PF11753 | DUF3310 | 0.74 |
PF01555 | N6_N4_Mtase | 0.74 |
PF07484 | Collar | 0.74 |
PF01551 | Peptidase_M23 | 0.74 |
PF13392 | HNH_3 | 0.74 |
PF13640 | 2OG-FeII_Oxy_3 | 0.74 |
PF03819 | MazG | 0.74 |
PF05065 | Phage_capsid | 0.74 |
PF08343 | RNR_N | 0.74 |
PF01726 | LexA_DNA_bind | 0.74 |
PF08443 | RimK | 0.74 |
PF11160 | Hva1_TUDOR | 0.74 |
PF10145 | PhageMin_Tail | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 2.21 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.74 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.74 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.74 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.47 % |
Unclassified | root | N/A | 23.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2149837010|LBLPr__contig00767 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
2149837010|LBLPr__contig02978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
2166559021|LBLPB2_contig00048 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
3300000268|M3P_10114761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
3300000929|NpDRAFT_10122444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300002220|MLSBCLC_10719895 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300002835|B570J40625_100094758 | All Organisms → Viruses → Predicted Viral | 3732 | Open in IMG/M |
3300002835|B570J40625_100984613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300003216|JGI26079J46598_1003936 | Not Available | 5374 | Open in IMG/M |
3300003430|JGI25921J50272_10114262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300004282|Ga0066599_100049551 | All Organisms → Viruses → Predicted Viral | 1705 | Open in IMG/M |
3300005582|Ga0049080_10153890 | Not Available | 770 | Open in IMG/M |
3300005662|Ga0078894_10077697 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
3300005662|Ga0078894_11277090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300005662|Ga0078894_11329050 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 603 | Open in IMG/M |
3300005662|Ga0078894_11687003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300005662|Ga0078894_11757067 | Not Available | 507 | Open in IMG/M |
3300005909|Ga0075112_1046964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300005919|Ga0075114_10192079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300005941|Ga0070743_10212924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300006484|Ga0070744_10006542 | All Organisms → Viruses → Predicted Viral | 3493 | Open in IMG/M |
3300006875|Ga0075473_10211992 | Not Available | 782 | Open in IMG/M |
3300006875|Ga0075473_10311322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300007162|Ga0079300_10036415 | All Organisms → Viruses → Predicted Viral | 1644 | Open in IMG/M |
3300007537|Ga0102934_1025607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3316 | Open in IMG/M |
3300007553|Ga0102819_1085592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300007609|Ga0102945_1026145 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
3300007860|Ga0105735_1089468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300008107|Ga0114340_1002562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10556 | Open in IMG/M |
3300008107|Ga0114340_1084628 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
3300008110|Ga0114343_1002260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16363 | Open in IMG/M |
3300008110|Ga0114343_1033961 | All Organisms → Viruses → Predicted Viral | 2102 | Open in IMG/M |
3300008113|Ga0114346_1062960 | All Organisms → Viruses → Predicted Viral | 3298 | Open in IMG/M |
3300008267|Ga0114364_1008413 | All Organisms → Viruses → Predicted Viral | 4923 | Open in IMG/M |
3300008448|Ga0114876_1004553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8989 | Open in IMG/M |
3300008448|Ga0114876_1014047 | All Organisms → Viruses → Predicted Viral | 4404 | Open in IMG/M |
3300009009|Ga0105105_10537126 | Not Available | 674 | Open in IMG/M |
3300009058|Ga0102854_1111644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300009155|Ga0114968_10006263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8784 | Open in IMG/M |
3300009155|Ga0114968_10213612 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
3300009158|Ga0114977_10012367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5401 | Open in IMG/M |
3300009165|Ga0105102_10004875 | All Organisms → Viruses → Predicted Viral | 4856 | Open in IMG/M |
3300009182|Ga0114959_10385463 | Not Available | 687 | Open in IMG/M |
3300009194|Ga0114983_1001940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7888 | Open in IMG/M |
3300009194|Ga0114983_1005609 | All Organisms → Viruses → Predicted Viral | 4118 | Open in IMG/M |
3300009194|Ga0114983_1062646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300009419|Ga0114982_1000734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17138 | Open in IMG/M |
3300009419|Ga0114982_1106228 | Not Available | 867 | Open in IMG/M |
3300010388|Ga0136551_1000002 | Not Available | 95625 | Open in IMG/M |
3300010388|Ga0136551_1001005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7425 | Open in IMG/M |
3300010388|Ga0136551_1004604 | Not Available | 3160 | Open in IMG/M |
3300011183|Ga0136713_1027149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300012000|Ga0119951_1001763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12479 | Open in IMG/M |
3300012347|Ga0157142_1000233 | Not Available | 22245 | Open in IMG/M |
3300012352|Ga0157138_1000022 | Not Available | 46323 | Open in IMG/M |
3300012667|Ga0157208_10009401 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
3300012667|Ga0157208_10028225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300013004|Ga0164293_10000034 | Not Available | 83753 | Open in IMG/M |
3300013004|Ga0164293_10015775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6340 | Open in IMG/M |
3300013004|Ga0164293_10796334 | Not Available | 599 | Open in IMG/M |
3300013005|Ga0164292_10167105 | All Organisms → Viruses → Predicted Viral | 1594 | Open in IMG/M |
3300013006|Ga0164294_10619708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300014962|Ga0134315_1002955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3044 | Open in IMG/M |
3300014962|Ga0134315_1021645 | Not Available | 997 | Open in IMG/M |
3300017766|Ga0181343_1034490 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
3300017766|Ga0181343_1070756 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
3300017766|Ga0181343_1153552 | Not Available | 641 | Open in IMG/M |
3300018410|Ga0181561_10034126 | All Organisms → Viruses → Predicted Viral | 3406 | Open in IMG/M |
3300020048|Ga0207193_1000195 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae | 109190 | Open in IMG/M |
3300020048|Ga0207193_1047969 | Not Available | 4532 | Open in IMG/M |
3300020048|Ga0207193_1140882 | All Organisms → Viruses → Predicted Viral | 2053 | Open in IMG/M |
3300020048|Ga0207193_1446461 | Not Available | 859 | Open in IMG/M |
3300020151|Ga0211736_10644754 | All Organisms → Viruses → Predicted Viral | 1431 | Open in IMG/M |
3300020490|Ga0208052_100492 | All Organisms → Viruses → Predicted Viral | 3512 | Open in IMG/M |
3300021141|Ga0214163_1009884 | All Organisms → Viruses → Predicted Viral | 3203 | Open in IMG/M |
3300021141|Ga0214163_1066278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300021438|Ga0213920_1060589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300021961|Ga0222714_10295103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300021962|Ga0222713_10294962 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300021962|Ga0222713_10642009 | Not Available | 613 | Open in IMG/M |
3300021963|Ga0222712_10016496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6333 | Open in IMG/M |
3300021963|Ga0222712_10024184 | All Organisms → Viruses → Predicted Viral | 4961 | Open in IMG/M |
3300021963|Ga0222712_10353078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300021963|Ga0222712_10376272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300021963|Ga0222712_10495126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300022591|Ga0236341_1029214 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
3300022821|Ga0222673_1008622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1885 | Open in IMG/M |
3300022874|Ga0222685_1051454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300023174|Ga0214921_10018577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7607 | Open in IMG/M |
3300023244|Ga0222627_1036024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300024346|Ga0244775_10000378 | Not Available | 56048 | Open in IMG/M |
3300024346|Ga0244775_10096345 | All Organisms → Viruses → Predicted Viral | 2517 | Open in IMG/M |
3300024346|Ga0244775_11123345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300024348|Ga0244776_10003221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15949 | Open in IMG/M |
3300024496|Ga0255151_1039614 | Not Available | 790 | Open in IMG/M |
(restricted) 3300024518|Ga0255048_10081596 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
3300025636|Ga0209136_1004247 | Not Available | 7728 | Open in IMG/M |
3300026094|Ga0209937_1075563 | Not Available | 542 | Open in IMG/M |
3300026097|Ga0209953_1000014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 101544 | Open in IMG/M |
3300026097|Ga0209953_1028121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300027185|Ga0208672_1000002 | Not Available | 98152 | Open in IMG/M |
3300027190|Ga0208674_1038621 | Not Available | 716 | Open in IMG/M |
3300027365|Ga0209300_1001967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7814 | Open in IMG/M |
3300027365|Ga0209300_1002728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6381 | Open in IMG/M |
3300027693|Ga0209704_1039676 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
3300027710|Ga0209599_10000852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17121 | Open in IMG/M |
3300027710|Ga0209599_10029817 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1025383 | All Organisms → Viruses → Predicted Viral | 4064 | Open in IMG/M |
3300027733|Ga0209297_1049838 | All Organisms → Viruses → Predicted Viral | 1894 | Open in IMG/M |
3300027805|Ga0209229_10088726 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
3300027963|Ga0209400_1002068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15505 | Open in IMG/M |
3300027963|Ga0209400_1261031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300028025|Ga0247723_1000040 | Not Available | 72814 | Open in IMG/M |
3300028025|Ga0247723_1000195 | Not Available | 39102 | Open in IMG/M |
3300028025|Ga0247723_1001518 | Not Available | 13467 | Open in IMG/M |
3300028025|Ga0247723_1001569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13248 | Open in IMG/M |
3300028025|Ga0247723_1116777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300028025|Ga0247723_1144690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1007947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12693 | Open in IMG/M |
3300031963|Ga0315901_10628483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300033992|Ga0334992_0055452 | All Organisms → Viruses → Predicted Viral | 2239 | Open in IMG/M |
3300033992|Ga0334992_0234397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
3300033992|Ga0334992_0297115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → Sphingobacterium yanglingense | 758 | Open in IMG/M |
3300033994|Ga0334996_0002439 | Not Available | 12689 | Open in IMG/M |
3300033994|Ga0334996_0405121 | Not Available | 639 | Open in IMG/M |
3300034018|Ga0334985_0002092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16009 | Open in IMG/M |
3300034018|Ga0334985_0532226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300034062|Ga0334995_0120564 | All Organisms → Viruses → Predicted Viral | 1946 | Open in IMG/M |
3300034073|Ga0310130_0001476 | Not Available | 12748 | Open in IMG/M |
3300034092|Ga0335010_0429591 | Not Available | 714 | Open in IMG/M |
3300034102|Ga0335029_0520489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300034104|Ga0335031_0027016 | All Organisms → Viruses → Predicted Viral | 4194 | Open in IMG/M |
3300034104|Ga0335031_0682512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300034110|Ga0335055_0258100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300034117|Ga0335033_0086477 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
3300034117|Ga0335033_0577621 | Not Available | 526 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.91% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 7.35% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.62% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.15% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.41% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.68% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.68% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.68% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 2.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.94% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.21% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 2.21% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.21% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.47% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.47% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.47% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.47% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.74% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.74% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.74% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.74% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.74% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.74% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.74% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.74% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.74% |
Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.74% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.74% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2149837010 | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom | Environmental | Open in IMG/M |
2166559021 | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from peak-bloom 2 | Environmental | Open in IMG/M |
3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005909 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKF | Environmental | Open in IMG/M |
3300005919 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKM | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007537 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG | Environmental | Open in IMG/M |
3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
3300022874 | Saline water microbial communities from Ace Lake, Antarctica - #1077 | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023244 | Saline water microbial communities from Ace Lake, Antarctica - #93 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026094 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027185 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes) | Environmental | Open in IMG/M |
3300027190 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LBLPr_02728830 | 2149837010 | Freshwater | MDEQAEEIRADLRDYYNSPERYTFQDFEDIFQDRDPFEFL |
LBLPr_03585590 | 2149837010 | Freshwater | EQAEEIYADLKDYYANPGAYSMQDFEDIFQDRDPFEFL |
LBLPB2_02016620 | 2166559021 | Freshwater | VDEQAEEIKADLRDYYNSPERYTFQDFEDIFQDRDPFEFL |
M3P_101147612 | 3300000268 | Lotic | MDEQALEIREALEDYYANPEQYSFRDLEEIFQDRDPFEFL* |
NpDRAFT_101224443 | 3300000929 | Freshwater And Marine | MDEQALEIRQDLAEYYANPEQYSFADLEEIFQDRDPFEFL* |
MLSBCLC_107198952 | 3300002220 | Hydrocarbon Resource Environments | MDEQAVEIQEALSDYYSNPEQYTLSDFEEIFQDRDPFEFL* |
B570J40625_1000947582 | 3300002835 | Freshwater | VDEQAQEIMEALKDYYANPEQYSFADLEEIFQDRDPFEFL* |
B570J40625_1009846134 | 3300002835 | Freshwater | VKSNPFEGDEQGMEIMDALDEYYKNPQDYTFRDLEEIFQDRDPFEFL* |
JGI26079J46598_10039363 | 3300003216 | Marine | MDEQAVEIRENLAEYFKDPESYTLFDFEDIFQDRDPFEFL* |
JGI25921J50272_101142622 | 3300003430 | Freshwater Lake | MDEQAQEIRENLAEYYANPEEYSIEDFEEIFQDRDPFEFL* |
Ga0066599_1000495514 | 3300004282 | Freshwater | MDEQGLEIREALADYYANPELYTLADFEEIFQDRDPFEFL* |
Ga0049080_101538903 | 3300005582 | Freshwater Lentic | MDEQAMEIREAWAEYLENPEDYTLADIEEIFQDRDPFEFI* |
Ga0078894_100776975 | 3300005662 | Freshwater Lake | MDEQAQEIRENLAEYYANPEEYSLEDFEDIFQDRDPFEFL* |
Ga0078894_112770904 | 3300005662 | Freshwater Lake | MMDEQALEIQEALADYYANPEQYSFRDLEEIFQDRDPFEFL* |
Ga0078894_113290502 | 3300005662 | Freshwater Lake | MDEQAQEIRENLADYYANPEEYSLEDFEDIFQDRDPFEFL* |
Ga0078894_116870031 | 3300005662 | Freshwater Lake | MDEQAQEIRENLADYYANPEEYSLQDFEDIFQDRDPFEFL* |
Ga0078894_117570672 | 3300005662 | Freshwater Lake | MDEQAQEIRENLAEYYANPEEYSLQDFEDIFQDRDPFEFL* |
Ga0075112_10469641 | 3300005909 | Saline Lake | MDEQAIEIKENLADYYANPEQYTFADLEEIFQDRDPFEFL* |
Ga0075114_101920792 | 3300005919 | Saline Lake | MDEQAIEIKENLADYNANPEQYTFADLEEIFQDRDPFEFL* |
Ga0070743_102129243 | 3300005941 | Estuarine | MDEQAVEIRENLAEYFKDPESYTLFDFEEIFQDRDPFEFL* |
Ga0070744_100065424 | 3300006484 | Estuarine | MDEQADEIREALEDYYANPESYSFYDFEEIFQDRDPFEFL* |
Ga0075473_102119922 | 3300006875 | Aqueous | MNDEQAQEILEALAEYYENPQDYSLEDWEEIFQDRDPFEFL* |
Ga0075473_103113222 | 3300006875 | Aqueous | MAKSNWEDDEQAMEILEDLQDWYENPQAYSMQDFEDIFQDRDPFEFL* |
Ga0079300_100364153 | 3300007162 | Deep Subsurface | MDEQALEIREALTEYYANPEEYTLADFEEIFQDRDPFEFL* |
Ga0102934_102560711 | 3300007537 | Pond Soil | MMDEQAEEIKEALGEYYQNPQNYNLEAWEEIFQDRDPFEFL* |
Ga0102819_10855922 | 3300007553 | Estuarine | NVRMEKSMDEQAVEIRENLAEYFKDPESYTLFDFEEIFQDRDPFEFL* |
Ga0102945_10261455 | 3300007609 | Pond Water | MDEQAEEIKEALGEYYQNPQNYNLEAWEEIFQDRDPFEFL* |
Ga0105735_10894681 | 3300007860 | Estuary Water | RKIMDEQADEIREAWAEYLANPEGYSLFDMEEIFQDRDPFEFI* |
Ga0114340_100256212 | 3300008107 | Freshwater, Plankton | MKKGTQMDEQAEEIRENLAEFYANPEDYTWQDFEDIFQDRDPFEFL* |
Ga0114340_10846287 | 3300008107 | Freshwater, Plankton | MDEQAQEIREALEDYYANPEQYSLADLEEIFQDRDPFE |
Ga0114343_100226039 | 3300008110 | Freshwater, Plankton | MDEQAQEIREALEDYYANPEQYSLADLEEIFQDRDPFEFL* |
Ga0114343_10339614 | 3300008110 | Freshwater, Plankton | MKKGTQMDEQAAEIRQDLADYYANPEEYTLADFEEIFQDRDPFEFL* |
Ga0114346_10629602 | 3300008113 | Freshwater, Plankton | MKKGTQMDEQAEESRENLAEFYANPEDYTWQDFEDIFQDRDPFEFL* |
Ga0114364_10084132 | 3300008267 | Freshwater, Plankton | MDEQAQEIREALEHYYANPEQYSLADLEEIFQDRDPFEFL* |
Ga0114876_100455323 | 3300008448 | Freshwater Lake | MKKGTPMDEQAAEIRENLADFYANPEDYTWQDFEDIFQDRDPFEFL* |
Ga0114876_10140474 | 3300008448 | Freshwater Lake | MKDDEQALEIIEALTEYYANPEAYSLADLEDIFQDRDPFEFL* |
Ga0105105_105371263 | 3300009009 | Freshwater Sediment | MDEQAVEIREAWAEYLANPEDYTLEDIEEIFQDRDPFEFI* |
Ga0102854_11116441 | 3300009058 | Estuarine | MDEQADEIREAWAEYLANPEGYSLFDMEEIFQDRDPFEFI* |
Ga0114968_1000626312 | 3300009155 | Freshwater Lake | MKDEQAEEIIANLKDYFENPEDYSLEEWEDIFQDRDPFEFL* |
Ga0114968_102136122 | 3300009155 | Freshwater Lake | MKSNPFEGDEQGMEIMEALDEYYANPEGYSYWDFEEIFQDRDPFEFL* |
Ga0114977_100123675 | 3300009158 | Freshwater Lake | MKDEQAEEILEALQDYYANPQDYSITDLEEIFQDRDPFEFL* |
Ga0105102_100048753 | 3300009165 | Freshwater Sediment | MDEQAEEIKADLRDYYNSPERYSFQDFEDIFQDRDPFEFL* |
Ga0114959_103854632 | 3300009182 | Freshwater Lake | MRDEQAEEIIEKLNDYYANPQDYSIQDWEDIFEDRDPFEFL* |
Ga0114983_10019407 | 3300009194 | Deep Subsurface | MDEQAEEIREALAEYYANPEDYTLEDFEEIFQDRDPFEFL* |
Ga0114983_100560914 | 3300009194 | Deep Subsurface | MDEQAQEIRQALEDYYANPEQYSFADFEEIFQDRDPIEFL* |
Ga0114983_10626462 | 3300009194 | Deep Subsurface | MDEQADEIREAWAEYLANPEDYSLQDMEDIFQDRDPFEFL* |
Ga0114982_100073426 | 3300009419 | Deep Subsurface | MDEQAAEIRENLADYYANPEEYTLEDFEEIFQDRDPFEFL* |
Ga0114982_11062282 | 3300009419 | Deep Subsurface | MTKNQIIDEQAEEIREALADYYANPEEYTLSDWEEIFQDRDPFEF |
Ga0136551_100000282 | 3300010388 | Pond Fresh Water | MDEQAEEIMADYRDYMANPGAYTMQDFEDIFQDRDPFEFI* |
Ga0136551_100100511 | 3300010388 | Pond Fresh Water | MDTQATEIIEALNDYYKNPEEYTFQDLEDIFQDRDPMEFL* |
Ga0136551_10046045 | 3300010388 | Pond Fresh Water | MSNQTEEIIEALNDYYLNPGEYTMQDLEDIFQDRDPTEFL* |
Ga0136713_10271491 | 3300011183 | Freshwater | MDEQAQEIRENLAEYYANPEEYSIEDFEDIFQDRDPFEFL* |
Ga0119951_100176319 | 3300012000 | Freshwater | MRDEQAEEIIEALKDYYANPEEYSLEDWEDIFQDRDPFEFM* |
Ga0157142_100023320 | 3300012347 | Freshwater | MDEQAEEIIADYQDYLANPGAYSMQDFEDIFQDRDPFEFI* |
Ga0157138_10000228 | 3300012352 | Freshwater | MDEQALEIQEALADYLANPEQYTLADFEEIFQDRDPFEFL* |
Ga0157208_100094016 | 3300012667 | Freshwater | MDEQAEEIMADYRDYMANPQAYTMQDFEDIFQDRDPFEFI* |
Ga0157208_100282252 | 3300012667 | Freshwater | MDEQAVEILENLEEYYANPQDYSLQDLEDIFQDRDPFEFL* |
Ga0164293_10000034101 | 3300013004 | Freshwater | MTKNQIIDEQAEEIREALADYYANPEEYTLEDWEEIFQDRDPFEFL* |
Ga0164293_100157757 | 3300013004 | Freshwater | MDEQAQEIREALEDYYANPEQYSFADFEEIFQDRDPIEFL* |
Ga0164293_107963341 | 3300013004 | Freshwater | LSVRKVSMDEQAAEIRENLADYYANPEEYSLQDFEDIFQDRDPFEFL* |
Ga0164292_101671055 | 3300013005 | Freshwater | MDEQAQEIREALEHYYANPEQYSFADFEEIFQDRDPFEFL* |
Ga0164294_106197082 | 3300013006 | Freshwater | MDEQADEIREALEDYYANPESYSLYDLEEIFQDRDPFEFL* |
Ga0134315_10029551 | 3300014962 | Surface Water | MDEQATEIREALAEYYENPEDYTLEDFEEIFQDRDPFEFL* |
Ga0134315_10216451 | 3300014962 | Surface Water | MDEQAQEIMEALNDYYANPQDYTFADFEEIFQDRDPIEFL* |
Ga0181343_10344903 | 3300017766 | Freshwater Lake | MDEQAQEIRENLADYYANPEEYSIEDFEEIFQDRDPFEFL |
Ga0181343_10707562 | 3300017766 | Freshwater Lake | MRDEQAEEILEALADYYANPQDYSIYDLEEIFQDRDPFEFL |
Ga0181343_11535521 | 3300017766 | Freshwater Lake | SYQLERQAMDEQAVEIRENLAEYYANPEEYSLEDFEDIFQDRDPFEFL |
Ga0181561_100341263 | 3300018410 | Salt Marsh | MDEQAQEILADLEDYYANPSAYSFQDLEDIFQDRDPFEFL |
Ga0207193_1000195142 | 3300020048 | Freshwater Lake Sediment | MDEQAEEIKENLADYYANPEEYTLEDFEEIFQDRDPFEFL |
Ga0207193_10479697 | 3300020048 | Freshwater Lake Sediment | MDEQAAEIRENLADYFANPSEYSFQDLEDIFQDRDPFEFL |
Ga0207193_11408825 | 3300020048 | Freshwater Lake Sediment | MDEQADEIREAWAEYLANPEDYSLQDMEDIFQDRDPFEFL |
Ga0207193_14464612 | 3300020048 | Freshwater Lake Sediment | MDEQAVEIRENLADYYANPEEYSLQDFEDIFQDRDPFEFL |
Ga0211736_106447542 | 3300020151 | Freshwater | MDEQALEIREALEDYYANPEQYSFRDLEEIFQDRDPFEFL |
Ga0208052_1004924 | 3300020490 | Freshwater | VDEQAQEIMEALKDYYANPEQYSFADLEEIFQDRDPFEFL |
Ga0214163_10098841 | 3300021141 | Freshwater | MDEQAIEIRQDLADYYANPEEYTLEDWEEIFQDRDPFEFL |
Ga0214163_10662783 | 3300021141 | Freshwater | MTKNQIIDEQAEEIREALADYYANPEEYTLEDWEEIFQDRDPFEFL |
Ga0213920_10605894 | 3300021438 | Freshwater | MDEQAEEIREALEDYYANPESYSLQDLEDIFQDRDPFEFL |
Ga0222714_102951034 | 3300021961 | Estuarine Water | MRDEQAEEIIANLNDYYENPEAYSLADLEEIFQDRDPFEFL |
Ga0222713_102949622 | 3300021962 | Estuarine Water | MKDEQAEEIIEALNHYYENPEEYSLEDWEDIFQDRDPFEFM |
Ga0222713_106420091 | 3300021962 | Estuarine Water | MDEQGQQIIEALQDYYENPMDYTMQDLEDIFQDRDPMEFL |
Ga0222712_100164963 | 3300021963 | Estuarine Water | MKDEQAEEIIANLQDYYANPEEYSIYDLEEIFQDRDPFEFL |
Ga0222712_1002418413 | 3300021963 | Estuarine Water | GMKDEQAQEILEALAEYYANPQDYTIADLEEIFQDRDPFEFL |
Ga0222712_103530781 | 3300021963 | Estuarine Water | MDEQAQEIIEALNEYYANPQDYTLADLEDIFQDRDPFEFL |
Ga0222712_103762721 | 3300021963 | Estuarine Water | MYNKVMRDEQAEEILEALADYYANPQDYSIYDLEEIFQDRDPFEFL |
Ga0222712_104951262 | 3300021963 | Estuarine Water | MDEQALEIQEALADYYANPEQYSFRDLEEIFQDRDPFEFL |
Ga0236341_10292143 | 3300022591 | Freshwater | MRDEQAEEIIANLKDYYENPEDYSLEDLEEIFQDRDPFEFL |
Ga0222673_10086229 | 3300022821 | Saline Water | MDEQAIEIKENLADYYANPEQYTFADLEEIFQDRDPFEFL |
Ga0222685_10514541 | 3300022874 | Saline Water | MDEQAIEIKENLADYYANPEQYTFADLEEIFQDRDPFEFLXKWYG |
Ga0214921_1001857714 | 3300023174 | Freshwater | MRDEQAEEIIEALKDYYANPEEYSLEDWEDIFQDRDPFEFM |
Ga0222627_10360243 | 3300023244 | Saline Water | MDEQAIEIKENLADYYANPEQYTFADLEEIFQDRDPFEFLXKWYGSMGENGMVENN |
Ga0244775_100003782 | 3300024346 | Estuarine | MDEQADEIREALEDYYANPESYSFYDFEEIFQDRDPFEFL |
Ga0244775_100963458 | 3300024346 | Estuarine | MDEQADEIREALEDYYANPESYSLQDLEDIFQDRDPFEFL |
Ga0244775_111233452 | 3300024346 | Estuarine | MDEQADEIREALEDYYANPESYSLYDLEEIFQDRDPFEFL |
Ga0244776_1000322122 | 3300024348 | Estuarine | MDEQADEIREAWAEYLANPEGYSLFDMEEIFQDRDPFEFI |
Ga0255151_10396141 | 3300024496 | Freshwater | MYNRPMNDEQAKEILEALEEYYANPEAYTLEDWEEIFQDRDPF |
(restricted) Ga0255048_100815967 | 3300024518 | Seawater | LGLIDEQAVEIRENLAEYFKDPESYTLFDFEDIFQDRDPFEFL |
Ga0209136_100424710 | 3300025636 | Marine | MDEQAVEIRENLAEYFKDPESYTLFDFEDIFQDRDPFEFL |
Ga0209937_10755633 | 3300026094 | Pond Water | LEKVEMMDEQAEEIKEALGEYYQNPQNYNLEAWEEIFQDRDPFEFL |
Ga0209953_1000014113 | 3300026097 | Pond Water | MMDEQAEEIKEALGEYYQNPQNYNLEAWEEIFQDRDPFEFL |
Ga0209953_10281213 | 3300026097 | Pond Water | MDEQAQEIREDLKDYYANPQDYSLQDLEDIFQDRDPFEFL |
Ga0208672_10000021 | 3300027185 | Estuarine | MDEQAVEIRENLAEYFKDPESYTLFDFEEIFQDRDPFEFL |
Ga0208674_10386213 | 3300027190 | Estuarine | DEQAVEIRENLAEYFKDPESYTLFDFEEIFQDRDPFEFL |
Ga0209300_100196714 | 3300027365 | Deep Subsurface | MDEQAEEIREALAEYYANPEDYTLEDFEEIFQDRDPFEFL |
Ga0209300_10027288 | 3300027365 | Deep Subsurface | MDEQAQEIRQALEDYYANPEQYSFADFEEIFQDRDPIEFL |
Ga0209704_10396765 | 3300027693 | Freshwater Sediment | MDEQAEEIKADLRDYYNSPERYSFQDFEDIFQDRDPFEFL |
Ga0209599_1000085227 | 3300027710 | Deep Subsurface | MDEQAAEIRENLADYYANPEEYTLEDFEEIFQDRDPFEFL |
Ga0209599_100298171 | 3300027710 | Deep Subsurface | MDEQAQEIREALEDYYANPEQYSFADFEEIFQDRDPIEFL |
(restricted) Ga0247833_10253834 | 3300027730 | Freshwater | MRSNPFPDDEQATEIMADLDDYYANPEGYSFRDLEEIFQDRDPFEFL |
Ga0209297_10498382 | 3300027733 | Freshwater Lake | MKDEQAEEILEALQDYYANPQDYSITDLEEIFQDRDPFEFL |
Ga0209229_100887261 | 3300027805 | Freshwater And Sediment | MDEQAQEIREALEHYYANPEQYSLADLEEIFQDRDPFEFL |
Ga0209400_100206816 | 3300027963 | Freshwater Lake | MKDEQAEEIIANLKDYFENPEDYSLEEWEDIFQDRDPFEFL |
Ga0209400_12610313 | 3300027963 | Freshwater Lake | MKSNPFEGDEQGMEIMEALDEYYANPEGYSYWDFEEIFQDRDPFEFL |
Ga0247723_100004028 | 3300028025 | Deep Subsurface Sediment | MRSNPFPEDEQATEIMEALDDYYANPQEYSFRDLEEIFQDRDPFEFL |
Ga0247723_10001958 | 3300028025 | Deep Subsurface Sediment | MAKSNWENDEQGMEILEALRDWYENPQSYSMQAFEDIFQDRDPFEFL |
Ga0247723_10015189 | 3300028025 | Deep Subsurface Sediment | MKSNPFEGDEQGMEILDALEEWYENPQSYSMQDFEDIFQDRDPFEFL |
Ga0247723_10015699 | 3300028025 | Deep Subsurface Sediment | MTKNQIIDEQAEEIREALADYYANPEEYTLSDWEEIFQDRDPFEFL |
Ga0247723_11167773 | 3300028025 | Deep Subsurface Sediment | MDEQALEISEALEEYYANPQDYSLQDLEDIFQDRDPFEFL |
Ga0247723_11446903 | 3300028025 | Deep Subsurface Sediment | MRSNPFPEDEQATEIMEALDEYYANPQGYSMQDLEDIFQDRDPFEFL |
(restricted) Ga0247843_100794725 | 3300028569 | Freshwater | MDEQAEEIREALEDYYANPESYSFYDFEEIFQDRDPFEFL |
Ga0315901_106284833 | 3300031963 | Freshwater | MDEQAEEIRENLAEFYANPEDYTWQDFEDIFQDRDPFEFL |
Ga0334992_0055452_1817_1939 | 3300033992 | Freshwater | MDEQAQEIVEALQDYYANPEQYSLFDFEEIFQDRDPFEFL |
Ga0334992_0234397_301_426 | 3300033992 | Freshwater | MMDEQALEIREALEDYYANPEQYSFRDLEEIFQDRDPFEFL |
Ga0334992_0297115_631_753 | 3300033992 | Freshwater | MDEQAQEIMEALKDYYANPEQYSLADLEEIFQDRDPFEFL |
Ga0334996_0002439_10367_10489 | 3300033994 | Freshwater | MDEQAIEIREAWAEYLANPEDYTLEDIEEIFQDRDPFEFI |
Ga0334996_0405121_302_424 | 3300033994 | Freshwater | MDEQAQEIREALEDYYANPEQYTFADFEEIFQDRDPIEFL |
Ga0334985_0002092_5318_5440 | 3300034018 | Freshwater | MDEQAAEIRENLADYYANPEEYSLSDFEEIFQDRDPFEFL |
Ga0334985_0532226_360_482 | 3300034018 | Freshwater | MDEQAQEIREALEHYYANPEQYSFADFEEIFQDRDPFEFL |
Ga0334995_0120564_1663_1785 | 3300034062 | Freshwater | MDEQAAEIRENLADYYANPEEYSLQDFEVIFQDRDPFEFL |
Ga0310130_0001476_1777_1899 | 3300034073 | Fracking Water | MDEQGLEIQEALADYYANPGEYTLQDFEDIFQDRDPFEFL |
Ga0335010_0429591_476_598 | 3300034092 | Freshwater | MDEQAAEIRENLADYYANPEEYSLQDFEDIFQDRDPFEFL |
Ga0335029_0520489_578_685 | 3300034102 | Freshwater | MDEQAQEIREALEHYYANPEQYSLADLEEIFQDRDP |
Ga0335031_0027016_2597_2737 | 3300034104 | Freshwater | MKKGTQMDEQAIEIREAWAEYLENPEDYTLADIEEIFQDRDPFEFI |
Ga0335031_0682512_282_434 | 3300034104 | Freshwater | MKKGTQMKTQVDEQAEEIREALADYYANPEEYTLEDFEEIFQDRDPFEFL |
Ga0335055_0258100_567_710 | 3300034110 | Freshwater | VKSNPFEGDEQGMEIMDALDEYYKNPQDYTFRDLEEIFQDRDPFEFL |
Ga0335033_0086477_191_313 | 3300034117 | Freshwater | MDEQGLEIQEALADYYANPEQYSFRDLEEIFQDRDPFEFL |
Ga0335033_0577621_409_525 | 3300034117 | Freshwater | EQAQEIREALEDYYANPEQYSFADFEEIFQDRDPIEFL |
⦗Top⦘ |