Basic Information | |
---|---|
Taxon OID | 2166559011 Open in IMG/M |
Scaffold ID | E4LJNJL01A8Y8Q Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from France, for comparison studies - Human5 (TS28 0613) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 544 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | St. Chamond, France | |||||||
Coordinates | Lat. (o) | 45.460129 | Long. (o) | 4.495284 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Human5-_01912930 | F026592 | N/A | CCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
⦗Top⦘ |