NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2166559011

2166559011: Human fecal microbial communities from France, for comparison studies - Human5 (TS28 0613)



Overview

Basic Information
IMG/M Taxon OID2166559011 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047475 | Gp0052409 | Ga0010970
Sample NameHuman fecal microbial communities from France, for comparison studies - Human5 (TS28 0613)
Sequencing StatusPermanent Draft
Sequencing Center454 Life Sciences
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size95343112
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationSt. Chamond, France
CoordinatesLat. (o)45.460129Long. (o)4.495284Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026592Metagenome / Metatranscriptome197Y
F068855Metagenome124N
F089054Metagenome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
E4LJNJL01A2TZHAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae538Open in IMG/M
E4LJNJL01A8Y8QNot Available544Open in IMG/M
E4LJNJL02BVQHDNot Available528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
E4LJNJL01A2TZHHuman5-_00269490F068855VPTVEAQGPQVRKSLALQGLQAEKERENANVQNAGWLHSFDADYHYHGSDLHYHVNVSAALSEGGTVW
E4LJNJL01A8Y8QHuman5-_01912930F026592CCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE
E4LJNJL02BVQHDHuman5-_02007780F089054GKFLVPRKIPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSKHIRLQIREMLQIPLRDITIIDIISLP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.