| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2166559011 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047475 | Gp0052409 | Ga0010970 |
| Sample Name | Human fecal microbial communities from France, for comparison studies - Human5 (TS28 0613) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | 454 Life Sciences |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 95343112 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | St. Chamond, France | |||||||
| Coordinates | Lat. (o) | 45.460129 | Long. (o) | 4.495284 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F068855 | Metagenome | 124 | N |
| F089054 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| E4LJNJL01A2TZH | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 538 | Open in IMG/M |
| E4LJNJL01A8Y8Q | Not Available | 544 | Open in IMG/M |
| E4LJNJL02BVQHD | Not Available | 528 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| E4LJNJL01A2TZH | Human5-_00269490 | F068855 | VPTVEAQGPQVRKSLALQGLQAEKERENANVQNAGWLHSFDADYHYHGSDLHYHVNVSAALSEGGTVW |
| E4LJNJL01A8Y8Q | Human5-_01912930 | F026592 | CCLRTASPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
| E4LJNJL02BVQHD | Human5-_02007780 | F089054 | GKFLVPRKIPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSKHIRLQIREMLQIPLRDITIIDIISLP |
| ⦗Top⦘ |