Scaffold WHMMB_Assembly_3_Contig_5087

Overview

Basic Information

• Taxon OID: 2166559003
• Scaffold ID: WHMMB_Assembly_3_Contig_5087
• Source Dataset Name: MMB 454-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 861
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Environment → Marine Sediment Microbial Communities From Little Sippewissett, Falmouth, Ma, That Are Multicellular And Magnetotactic

Source Dataset Sampling Location

• Location Name: Little Sippewissett, Falmouth, MA
• Coordinates
  • Lat. (^o): 41.57585
  • Long. (^o): -70.63581
  • Depth (m): 0 to .15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058891	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
WHMMB_0087.00000560	F058891	GGAG	MDKKQVLLFIKERHEALSRMKAAKFSGRITREEQKLYQEAWSYIDPKAKVCFTCGRSPQIMSVALLNYYEANKPKRRKKSEVQQRL