2166559003: MMB 454-1

Overview

Basic Information

• IMG/M Taxon OID: 2166559003
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047445 | Gp0052375 | Ga0010952
• Sample Name: MMB 454-1
• Sequencing Status: Permanent Draft
• Sequencing Center: Pennsylvania State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12769521
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	1
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Sediment Microbial Communities From Little Sippewissett, Falmouth, Ma, That Are Multicellular And Magnetotactic
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Environment → Marine Sediment Microbial Communities From Little Sippewissett, Falmouth, Ma, That Are Multicellular And Magnetotactic

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine salt marsh biome → saline marsh → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: Little Sippewissett, Falmouth, MA
• Coordinates
  • Lat. (^o): 41.57585
  • Long. (^o): -70.63581
  • Alt. (m): N/A
  • Depth (m): 0 to .15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058891	Metagenome / Metatranscriptome	134	N
F083429	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
WHMMB_Assembly_3_Contig_10	All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	3589
WHMMB_Assembly_3_Contig_5087	All Organisms → cellular organisms → Bacteria → Proteobacteria	861

Sequences

Scaffold ID	Protein ID	Family	Sequence
WHMMB_Assembly_3_Contig_10	WHMMB_0010.00000190	F083429	MARYQKKSKTTYGKAFKKKSSSGKFRKGTLVKYKYQNGRRVGTVKARK
WHMMB_Assembly_3_Contig_5087	WHMMB_0087.00000560	F058891	MDKKQVLLFIKERHEALSRMKAAKFSGRITREEQKLYQEAWSYIDPKAKVCFTCGRSPQIMSVALLNYYEANKPKRRKKSEVQQRL