Scaffold WHMMB_Assembly_3_Contig_10

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold WHMMB_Assembly_3_Contig_10

Scaffold WHMMB_Assembly_3_Contig_10

Overview

Basic Information
Taxon OID	2166559003 Open in IMG/M
Scaffold ID	WHMMB_Assembly_3_Contig_10 Open in IMG/M
Source Dataset Name	MMB 454-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3589
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (44.44%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Environment → Marine Sediment Microbial Communities From Little Sippewissett, Falmouth, Ma, That Are Multicellular And Magnetotactic

Source Dataset Sampling Location
Location Name	Little Sippewissett, Falmouth, MA
Coordinates	Lat. (^o)	41.57585	Long. (^o)	-70.63581	Alt. (m)		Depth (m)	0 to .15
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083429	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
WHMMB_0010.00000190	F083429	AGGAG	MARYQKKSKTTYGKAFKKKSSSGKFRKGTLVKYKYQNGRRVGTVKARK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.