| Basic Information | |
|---|---|
| Taxon OID | 2166559003 Open in IMG/M |
| Scaffold ID | WHMMB_Assembly_3_Contig_10 Open in IMG/M |
| Source Dataset Name | MMB 454-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3589 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (44.44%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Environment → Marine Sediment Microbial Communities From Little Sippewissett, Falmouth, Ma, That Are Multicellular And Magnetotactic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Little Sippewissett, Falmouth, MA | |||||||
| Coordinates | Lat. (o) | 41.57585 | Long. (o) | -70.63581 | Alt. (m) | Depth (m) | 0 to .15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083429 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| WHMMB_0010.00000190 | F083429 | AGGAG | MARYQKKSKTTYGKAFKKKSSSGKFRKGTLVKYKYQNGRRVGTVKARK |
| ⦗Top⦘ |