NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SwRhRL2b_contig_2014690

Scaffold SwRhRL2b_contig_2014690


Overview

Basic Information
Taxon OID2162886007 Open in IMG/M
Scaffold IDSwRhRL2b_contig_2014690 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1331
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.794771Long. (o)-84.393804Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035811Metagenome171Y

Sequences

Protein IDFamilyRBSSequence
SwRhRL2b_0696.00008340F035811N/AFLNLGLPLEAGTYNLKLTVGGKDYTTKIVIENDPGM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.