Scaffold GZIBSPL01A53KL

Overview

Basic Information

• Taxon OID: 2156126007
• Scaffold ID: GZIBSPL01A53KL
• Source Dataset Name: Estuarine microbial communities from Columbia river, CM, sample from South Channel ETM site, CRE-ETM-794-796
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River estuary, South Channel ETM site near Astoria (OR)
• Coordinates
  • Lat. (^o): 46.201
  • Long. (^o): -123.821
  • Depth (m): 14

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087745	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
GZIBSPL01_0423.00000210	F087745	GAGG	MSDTTVLLQPVGIVHTPKDLKELEAYIGKFHGGEAIAAFTCAWMAWNLCAKLTNPEGRKADEHA