| Basic Information | |
|---|---|
| Taxon OID | 2156126005 Open in IMG/M |
| Scaffold ID | TCCM__contig04349 Open in IMG/M |
| Source Dataset Name | Marine Trichodesmium cyanobacterial communities from the Bermuda Atlantic Time-Series |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 912 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Trichodesmium Cyanobacterial Communities From The Bermuda Atlantic Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 25.5 | Long. (o) | -67.3 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032301 | Metagenome / Metatranscriptome | 180 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TCCM_0349.00000250 | F032301 | GGA | VASKLSPQQADGFFYQSDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELPAKIGRCCNRRYGHTFQNSA |
| ⦗Top⦘ |