| Basic Information | |
|---|---|
| Taxon OID | 2156126001 Open in IMG/M |
| Scaffold ID | 2157641616 Open in IMG/M |
| Source Dataset Name | Compost microbial communities from Sao Paulo Zoo, Brazil - C5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Sao Paulo, Virginia Bioinformatics Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 531 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Paulo Zoo, Brazil | |||||||
| Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010992 | Metagenome | 296 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2157315008 | F010992 | N/A | NKSILLLQNVEGSLSDVTVTEVTRQVGLVGINAVTSIGPDLAYVSYGNINLLTLTSTNNSLQHKTLPLSTKIKATMRRVNWKAGYKISLGYWSNRLYVSLPLDNSPFCNTVVVYNFTTEEWYGEWNFSPDINLAIQGFQVVDYIKQQRMHIVSEDGRIWSWMKATMTSSPDRRWKF |
| ⦗Top⦘ |