| Basic Information | |
|---|---|
| Taxon OID | 2149837027 Open in IMG/M |
| Scaffold ID | CHXX__Locus922v1rpkm106_87 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-1 Below Plume |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 587 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.716667 | Long. (o) | -88.466667 | Alt. (m) | Depth (m) | 1300 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104104 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CHXX_0243.00000010 | F104104 | N/A | VQAMGATIVYTMNPKRQPTEVYDLKVLTVVTDCARGGYGQMSDDLKCAVGEGDKEKRGAAGHVTLTFAEGGQLVTSMGHWIELTKIDASVESVMQVAAHNFGGVEAENFRRVYMEQATDADRSAWVQQNCHRYVTQSAPSRMKCRTKF |
| ⦗Top⦘ |