NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2149837027

2149837027: Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-1 Below Plume



Overview

Basic Information
IMG/M Taxon OID2149837027 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047147 | Gp0052347 | Ga0010884
Sample NameMarine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-1 Below Plume
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size43595665
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin11
Not Available1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine black smoker biomeblack smokersea water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)28.716667Long. (o)-88.466667Alt. (m)N/ADepth (m)1300
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004471Metagenome / Metatranscriptome437Y
F067833Metagenome / Metatranscriptome125Y
F076161Metagenome / Metatranscriptome118N
F104104Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
CHXX__Locus11409v1rpkm25_35All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium502Open in IMG/M
CHXX__Locus32v1rpkm604_63All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin11095Open in IMG/M
CHXX__Locus3405v1rpkm68_55Not Available647Open in IMG/M
CHXX__Locus5093v1rpkm57_51All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium549Open in IMG/M
CHXX__Locus922v1rpkm106_87All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae587Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
CHXX__Locus11409v1rpkm25_35CHXX_0928.00000740F067833VMMVVIQLVKIKVYGIVAMANVFQQAMYVMAQMNSAMPDGDLTVTMAQMKA
CHXX__Locus32v1rpkm604_63CHXX_0034.00000020F076161MKSINFSSRCPKTGFRAFAEKPVAKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIAADPKEHSNLLSSPTNPDAPTGKPV
CHXX__Locus3405v1rpkm68_55CHXX_0090.00000600F004471GALIELDDSRGSIKAVVNMNGQKLAGQAIKVSFTKIDLAGMKNDKKSKDLREAKENWRFSNNKEAKFRKMCLSRLKKLSSSITVLNIPEGKSDLVKKHIIESGYTVKSIEGSRRPDDKDKPKPSTGYTVAFVELASVEEAIAAVANLHNTWPKKFGTMKNDGYGNARGLVFALGGVKQEQLEKSKA
CHXX__Locus5093v1rpkm57_51CHXX_0716.00000900F067833TVLMKLIVLLLHVKTKVFGIVAMANVFQHHMYVMDHLNSVTQDGLLTVLMAQMKA
CHXX__Locus922v1rpkm106_87CHXX_0243.00000010F104104VQAMGATIVYTMNPKRQPTEVYDLKVLTVVTDCARGGYGQMSDDLKCAVGEGDKEKRGAAGHVTLTFAEGGQLVTSMGHWIELTKIDASVESVMQVAAHNFGGVEAENFRRVYMEQATDADRSAWVQQNCHRYVTQSAPSRMKCRTKF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.