NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CHXX__Locus3405v1rpkm68_55

Scaffold CHXX__Locus3405v1rpkm68_55


Overview

Basic Information
Taxon OID2149837027 Open in IMG/M
Scaffold IDCHXX__Locus3405v1rpkm68_55 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-1 Below Plume
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)28.716667Long. (o)-88.466667Alt. (m)Depth (m)1300
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004471Metagenome / Metatranscriptome437Y

Sequences

Protein IDFamilyRBSSequence
CHXX_0090.00000600F004471N/AGALIELDDSRGSIKAVVNMNGQKLAGQAIKVSFTKIDLAGMKNDKKSKDLREAKENWRFSNNKEAKFRKMCLSRLKKLSSSITVLNIPEGKSDLVKKHIIESGYTVKSIEGSRRPDDKDKPKPSTGYTVAFVELASVEEAIAAVANLHNTWPKKFGTMKNDGYGNARGLVFALGGVKQEQLEKSKA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.