Scaffold STU__NODE_4677_len_5736_cov_74_025108

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold STU__NODE_4677_len_5736_cov_74_025108

Scaffold STU__NODE_4677_len_5736_cov_74_025108

Overview

Basic Information
Taxon OID	2149837021 Open in IMG/M
Scaffold ID	STU__NODE_4677_len_5736_cov_74_025108 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from the University of Arizona (HMP) - UAf1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chinese National Human Genome Center, Beijing
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5794
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location Name	Arizona, USA
Coordinates	Lat. (^o)	32.23	Long. (^o)	-110.95	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0483.00001050	F051936	N/A	GFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.