Scaffold STU__NODE_11423_len_5933_cov_49_790493

Overview

Basic Information

• Taxon OID: 2149837021
• Scaffold ID: STU__NODE_11423_len_5933_cov_49_790493
• Source Dataset Name: Human fecal microbial communities from the University of Arizona (HMP) - UAf1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chinese National Human Genome Center, Beijing
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5991
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location

• Location Name: Arizona, USA
• Coordinates
  • Lat. (^o): 32.23
  • Long. (^o): -110.95

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0846.00000950	F051936	N/A	TGQVLFFPLALRGKAFGFRVLQEHAVMTPVISIFFAMLIIRHLSIHISIKK