Scaffold STU__NODE_12424_len_686_cov_13_258018

Overview

Basic Information

• Taxon OID: 2149837018
• Scaffold ID: STU__NODE_12424_len_686_cov_13_258018
• Source Dataset Name: Human fecal microbial communities from the University of Arizona (HMP) - Em1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chinese National Human Genome Center, Beijing
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 714
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location

• Location Name: Bording, Denmark
• Coordinates
  • Lat. (^o): 56.13
  • Long. (^o): 9.24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090513	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0652.00000530	F090513	N/A	MAKYVRKMEWKLLHIKHILYMQPFGALKIAPQSVENKNGTKAVLQGWAAAFVPYMLSFT