NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold STU__NODE_6981_len_1674_cov_21_643967

Scaffold STU__NODE_6981_len_1674_cov_21_643967


Overview

Basic Information
Taxon OID2149837017 Open in IMG/M
Scaffold IDSTU__NODE_6981_len_1674_cov_21_643967 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from the University of Arizona (HMP) - Ef3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChinese National Human Genome Center, Beijing
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1702
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location NameBording, Denmark
CoordinatesLat. (o)56.13Long. (o)9.24Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044555Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
STU_0941.00000350F044555N/AMKTTNPSSRITISQNGNQILTCKVYKEPNYILSMSNEEILELISGLDYIGNIPTVPDLEKPIEIQVSTIRQIPLEQNKEVQTKIKEIIYNNLYDTLVDELKDTISRFQAQYNIQEINPYLQDILQNPEDLVSLSQHHKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.