Scaffold STU__NODE_1508_len_11491_cov_32_124706

Overview

Basic Information

• Taxon OID: 2149837015
• Scaffold ID: STU__NODE_1508_len_11491_cov_32_124706
• Source Dataset Name: Human fecal microbial communities from the University of Arizona (HMP) - Ef1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chinese National Human Genome Center, Beijing
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11513
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (13.04%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location

• Location Name: Bording, Denmark
• Coordinates
  • Lat. (^o): 56.128817
  • Long. (^o): 9.239502

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089054	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0348.00001130	F089054	N/A	MLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSEHIRLQIREMLQIPLSDITIIDIISLP