2149837015: Human fecal microbial communities from the University of Arizona (HMP) - Ef1

Overview

Basic Information

• IMG/M Taxon OID: 2149837015
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047181 | Gp0052328 | Ga0026456
• Sample Name: Human fecal microbial communities from the University of Arizona (HMP) - Ef1
• Sequencing Status: Permanent Draft
• Sequencing Center: Chinese National Human Genome Center, Beijing
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 16681402
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Bacteroides phage B40-8	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Bording, Denmark
• Coordinates
  • Lat. (^o): 56.128817
  • Long. (^o): 9.239502
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N
F089054	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
STU__NODE_1022_len_8874_cov_12_166780	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Bacteroides phage B40-8	8896
STU__NODE_1508_len_11491_cov_32_124706	All Organisms → cellular organisms → Bacteria	11513

Sequences

Scaffold ID	Protein ID	Family	Sequence
STU__NODE_1022_len_8874_cov_12_166780	STU_0906.00000060	F055775	MAQIAQQDNLVIEVTTTAEALDGDTKKKLIECIEGGTITDVILVTKEAEKEISHARVVSWLVDTTGDSPKYTIDIINANSGTVKAIALN
STU__NODE_1508_len_11491_cov_32_124706	STU_0348.00001130	F089054	MLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSEHIRLQIREMLQIPLSDITIIDIISLP