| Basic Information | |
|---|---|
| Taxon OID | 2140918032 Open in IMG/M |
| Scaffold ID | NODE_77885_length_636_cov_4.899371 Open in IMG/M |
| Source Dataset Name | Bovine rumen microbial communities from Vernon, TX, USA, Sample 669 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Texas A and M University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 678 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella ruminicola | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Microbial Communities From Vernon, Tx, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Vernon, Texas | |||||||
| Coordinates | Lat. (o) | 34.154 | Long. (o) | -99.264 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081939 | Metagenome / Metatranscriptome | 114 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| RumX_01894570 | F081939 | GGAG | MVKKKEKALTKREKVGMLADKLNEAINSCKLEPTEELDIFAESVALLIAYWGKISDWSPIEKASYVGYVTTTVLEKGLDAEIKSFEEHRKSMKPQIGN |
| ⦗Top⦘ |