NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold contig02712

Scaffold contig02712


Overview

Basic Information
Taxon OID2140918001 Open in IMG/M
Scaffold IDcontig02712 Open in IMG/M
Source Dataset NameHot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - OSP_D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1496
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameOne Hundred Springs Plain, Yellowstone National Park
CoordinatesLat. (o)44.7315Long. (o)-110.711389Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087444Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
OSPD_00802540F087444N/AGVIYVYLVKAGFGTFVFATFDDGYSEYAHAIETLVARPALVTKPFVNVAKTIWDLLEQAEREFYDPFINNPFTQLLHDNETRTELIVTVRKLLESGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.