Scaffold contig01294

Overview

Basic Information

• Taxon OID: 2140918001
• Scaffold ID: contig01294
• Source Dataset Name: Hot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - OSP_D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2876
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Desulfurococcales → Desulfurococcaceae → Ignisphaera → Ignisphaera aggregans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: One Hundred Springs Plain, Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.7315
  • Long. (^o): -110.711389

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026309	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
OSPD_00262630	F026309	GAGG	MSLPAPLSSPNLFIGLVIFVVASILLYLGRIPLSAWTTIVGVLLGYYFGYQHGVSVSKGG