Scaffold MBSR2a_Contig_60

Overview

Basic Information

• Taxon OID: 2124908025
• Scaffold ID: MBSR2a_Contig_60
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample from Bulk Soil Replicate 2: eDNA_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1075
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan State University
• Coordinates
  • Lat. (^o): 42.406189
  • Long. (^o): -85.40016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093678	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
MBSR2a_00125770	F093678	AGGAG	MATKARTIKIADLSSVIDQAVQASAGRTLPGGTLIGRQIAASLAAKINPNDLARDITKQVKAAVPDATLTPKVIKDGKIIICGFIIKPQSPIQ