| Basic Information | |
|---|---|
| Taxon OID | 2124908015 Open in IMG/M |
| Scaffold ID | t454_GJGVOYN01C0G2I Open in IMG/M |
| Source Dataset Name | Tongue_dorsum_contig300 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Los Alamos National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 505 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Tongue → Human Tongue Microbial Communities From Los Alamos National Lab, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Houston, TX | |||||||
| Coordinates | Lat. (o) | 29.774 | Long. (o) | -95.361032 | Alt. (m) | Depth (m) | 95.383 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051213 | Metagenome | 144 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| t454_06608590 | F051213 | N/A | SKLLWAVVMALTFVLTSCDPFSKNEPTIEGDRYKYFDSSAQRQSFRVVNGSGKQYNHKVDWHIIGIQEENSDTYLTKKVDTLSNGDFRISYDWVTFTVKENKSVIDVEVQKNETGKDRSVFFATSNSYKQAYLPNMIVTQRAK |
| ⦗Top⦘ |