Scaffold sp300_12666842

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold sp300_12666842

Scaffold sp300_12666842

Overview

Basic Information
Taxon OID	2124908012 Open in IMG/M
Scaffold ID	sp300_12666842 Open in IMG/M
Source Dataset Name	Human Subgingival plaque microbiome from visit number 1 of subject 763496533
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Los Alamos National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5186
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (81.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque → Subgingival Plaque Microbial Communities From Los Alamos National Laboratory, Usa

Source Dataset Sampling Location
Location Name	St. Louis, MO, USA
Coordinates	Lat. (^o)	38.646	Long. (^o)	-90.224	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076191	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
sp300_03041960	F076191	AGGAGG	MKIIAENPAEEALLWRIKALSDEVVRQDNRYTSMPVWTILDNNKAGKDYGAVMYFTGKAAERHIEENDHHYDNPTTCIRSAHDNRELKDVIHLLILAGGNEIPSNHYGVLKDA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.