NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold s300_3046847

Scaffold s300_3046847


Overview

Basic Information
Taxon OID2124908011 Open in IMG/M
Scaffold IDs300_3046847 Open in IMG/M
Source Dataset NameHuman Saliva microbiome from visit number 1 of subject 763496533
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Saliva → Human Saliva Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location
Location NameSt. Louis, MO
CoordinatesLat. (o)38.646Long. (o)-90.224Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097525Metagenome104N

Sequences

Protein IDFamilyRBSSequence
s300_00392540F097525N/AMQQKKIMFKIQNAYQKIIFSIHGHRERKDNFEDWLKVEVKVKDDLEGKYYTRVSECMLFSEVLGLLEWFEQISADKEKSTEIDFIEPELAFEYQNKKLIVLLCYDIAPVSYGEEPYQLTFPLDDKTLAMIIKELGEAVASFKKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.