Scaffold kg300_3280911

Overview

Basic Information

• Taxon OID: 2124908010
• Scaffold ID: kg300_3280911
• Source Dataset Name: Keratinized_gingiva_contig300
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Los Alamos National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1676
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva → Keratinized Gingiva Microbial Communities From Saint Louis, Missouri, Usa

Source Dataset Sampling Location

• Location Name: St. Louis, MO
• Coordinates
  • Lat. (^o): 38.646
  • Long. (^o): -90.224

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018385	Metagenome	235	Y

Sequences

Protein ID	Family	RBS	Sequence
kg300_00734930	F018385	GGAG	MAEYVNQWESYKELSIENDRDPVLDNPIIYGVNVKHFTLTVYSPEGRVNKYWNARILKDQVGRCRIACPRDGKILCFAWFEWTSYMFSHDGLNELVFMPRMNSRLPSTLWNTKEVN